Showing 41–50 of 482 results
-
Magainin 2
- Sequence:
- (NH2-) GIGKFLHSAKKFGKAFVGEIMNS (-COOH)
- Cat. No.
- SP-MG2
- View product
-
Beta Amyloid 1-38
- Description:
- Beta Amyloid peptides are derived from amyloid precursor protein (APP) and are thought to play a role in the development of the...
- Sequence:
- DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
- Cat. No.
- SP-5348
- View product
-
Polyclonal normal rabbit IgG
- Description:
- Total IgG, purified by Protein G from a pool of serum collected from naïve (non-immunised) rabbits.
- Type:
- Polyclonal IgG
- Cat. No.
- PA-0000
- View product
-
CAP-18
- Description:
- Polyclonal antibody raised against the synthetic peptide CAP-18, which is the rabbit homologue of LL-37.
- Type:
- Polyclonal IgY
- Cat. No.
- PA-CAP18
- View product
-
CAP-18
- Sequence:
- GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
- Cat. No.
- SP-4541
- View product
-
pTH 3-13 (rat)
- Sequence:
- SEIQLMHNLGK
- Cat. No.
- SP-5014
- View product
-
TRAP-6 2-6
- Description:
- The Thrombin Receptor Activator Peptide 6 (2-6) corresponds to aa 43-47 of the thrombin receptor.
- Sequence:
- FLLRN
- Cat. No.
- SP-5060
- View product
-
Apelin 13, myristoyl
- Sequence:
- QRPRLSHKGPMPF
- Cat. No.
- SP-5126
- View product
-
Apelin 13, Pyr1, V6
- Sequence:
- (Pyr)RPRLVHKGPMPF
- Cat. No.
- SP-5165
- View product
-
Apelin 13, Pyr1, 13C/15N, 5dL
- Sequence:
- (Pyr)RP*R(dL)SHKGPMP*F
- Cat. No.
- SP-5199
- View product
