Showing 401–410 of 482 results
-
Polyclonal normal goat IgG
- Description:
- Total IgG, purified by Protein G from a pool of serum collected from naïve (non-immunised) goats.
- Type:
- Polyclonal IgG
- Cat. No.
- PA-0001
- View product
-
CAP-18 biotin
- Description:
- Polyclonal antibody raised against the synthetic peptide CAP-18, which is the rabbit homologue of LL-37.
- Type:
- Polyclonal IgY
- Cat. No.
- PA-CAP18BT
- View product
-
LL-37 FK-13
- Description:
- This LL-37 fragment corresponds to aa 150-162 of the human cationic antimicrobial protein 18 (hCAP18).
- Sequence:
- FKRIVQRIKDFLR
- Cat. No.
- SP-4582
- View product
-
pTH 5-13 (rat)
- Sequence:
- IQLMHNLGK
- Cat. No.
- SP-5016
- View product
-
TRAP-5
- Description:
- The Thrombin Receptor Activator Peptide 5 corresponds to aa 42-46 of the thrombin receptor.
- Sequence:
- SFLLR
- Cat. No.
- SP-5062
- View product
-
Apelin 13, Pyr1, A02
- Sequence:
- (Pyr)APRLSHKGPMPF
- Cat. No.
- SP-5129
- View product
-
Apelin 13, Pyr1, Y6
- Sequence:
- (Pyr)RPRLYHKGPMPF
- Cat. No.
- SP-5167
- View product
-
FLUM1 (58-66)
- Sequence:
- GILGFVFTL
- Cat. No.
- SP-5202
- View product
-
beta Endorphin (human) biotin
- Sequence:
- (Biotin-) YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
- Cat. No.
- SP-5255
- View product
-
C-peptide 57-87
- Sequence:
- EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ
- Cat. No.
- SP-5311
- View product