Showing 191–200 of 482 results
-
Apelin 13, Pyr1, A07
- Sequence:
- (Pyr)RPRLSAKGPMPF
- Cat. No.
- SP-5134
- View product
-
Apelin 13, Pyr1, L13
- Sequence:
- (Pyr)RPRLSHKGPMPL
- Cat. No.
- SP-5172
- View product
-
Beta Amyloid 11-40, Pyr11
- Sequence:
- (Pyr)VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat. No.
- SP-5211
- View product
-
Substance P 5-FAM
- Sequence:
- (5-FAM-) RPKPQQFFGLM (-CONH2)
- Cat. No.
- SP-5261
- View product
-
V5 epitope tag
- Sequence:
- GKPIPNPLLGLDST
- Cat. No.
- SP-5321
- View product
-
beta Defensin 4 (human)
- Sequence:
- ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK
- Cat. No.
- SP-BDF4
- View product
-
Apelin 13, Pyr1 – Alanine scan
- Description:
- This set of twelve peptides forms a complete Alanine scan of Apelin 13. The amount states the amount delivered of each of...
- Cat. No.
- SP-5128
- View product
-
Beta Amyloid 11-40
- Sequence:
- EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat. No.
- SP-BA1140
- View product
-
Beta Amyloid 1-42; E22Q
- Sequence:
- DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
- Cat. No.
- SP-BA42Q22
- View product
-
Wrap53 C1
- Description:
- Polyclonal antibody raised against a synthetic Human Wrap53 peptide that maps to the C1 region of the full length Wrap53 protein. Applications...
- Type:
- Polyclonal IgG
- Cat. No.
- PA-2010
- View product