Showing 141–150 of 482 results
-
Beta Amyloid 40-1 (reverse)
- Description:
- Beta Amyloid peptides are derived from amyloid precursor protein (APP) and are thought to play a role in the development of the...
- Sequence:
- VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
- Cat. No.
- SP-BA40R
- View product
-
Beta Amyloid 42-1 (reverse)
- Description:
- Beta Amyloid peptides are derived from amyloid precursor protein (APP) and are thought to play a role in the development of the...
- Sequence:
- AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
- Cat. No.
- SP-BA42R
- View product
-
Wrap53 C1 biotin
- Description:
- Polyclonal antibody raised against a synthetic Human Wrap53 peptide that maps to the C1 region of the full length Wrap53 protein. Applications...
- Type:
- Polyclonal IgG
- Cat. No.
- PA-2010BT
- View product
-
LL-37 FITC
- Type:
- Polyclonal IgG
- Cat. No.
- PA-LL37F
- View product
-
Caspase 8 substrate AFC
- Sequence:
- IETD
- Cat. No.
- SP-5000
- View product
-
Beta Amyloid 17-40
- Sequence:
- LVFFAEDVGSNKGAIIGLMVGGVV
- Cat. No.
- SP-5043
- View product
-
TNF-a 72-82, human
- Sequence:
- PLAQAVRSSSR
- Cat. No.
- SP-5091
- View product
-
Apelin 13, Pyr1, I12
- Sequence:
- (Pyr)RPRLSHKGPMIF
- Cat. No.
- SP-5150
- View product
-
Apelin 13, Pyr1, K4, I12
- Sequence:
- (Pyr)RPKLSHKGPMIF
- Cat. No.
- SP-5184
- View product
-
Arg9 5-TAMRA
- Sequence:
- RRRRRRRRR
- Cat. No.
- SP-5226
- View product
