Showing 1–10 of 55 results
-
LL-37
- Description:
- The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18).
- Sequence:
- (NH2-) [LL-37, 37 aa] (-COOH)
- Cat. No.
- SP-LL37
- View product
-
LL-37 5-FAM
- Description:
- The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is labeled with...
- Sequence:
- (5-FAM-) [LL-37, 37 aa] (-COOH)
- Cat. No.
- SP-LL37F
- View product
-
LL-37 scrambled
- Description:
- The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is the scrambled...
- Sequence:
- (NH2-) GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR (-COOH)
- Cat. No.
- SP-LL37SCR
- View product
-
TNF-a 72-82, human
- Sequence:
- PLAQAVRSSSR
- Cat. No.
- SP-5091
- View product
-
Apelin 36, human
- Description:
- Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in...
- Sequence:
- LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
- Cat. No.
- SP-5118
- View product
-
Apelin 17, human
- Description:
- Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in...
- Sequence:
- KFRRQRPRLSHKGPMPF
- Cat. No.
- SP-5119
- View product
-
Apelin 13, Pyr1, human
- Description:
- Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in...
- Sequence:
- (Pyr)RPRLSHKGPMPF
- Cat. No.
- SP-5120
- View product
-
Apelin 12, human
- Description:
- Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in...
- Sequence:
- RPRLSHKGPMPF
- Cat. No.
- SP-5121
- View product
-
PAMP (human)
- Sequence:
- ARLDVASEFRKKWNKWALSR
- Cat. No.
- SP-5193
- View product
-
Hepcidin, human
- Sequence:
- DTHFPICIFCCGCCHRSKCGMCCKT
- Cat. No.
- SP-5247
- View product
