Catalog antibodies

Innovagen also offers a number of catalog antibodies. Click on individual peptides for details and ordering information.

Name	Immunogen					Clonality	Info
Ghrelin (rat)	Synthetic peptide (NH2-) GS(n-octanoyl-S)FLSPEHQKAQQRKESKKPPAKLQPR (-COOH)					Polyclonal	More info
LL-37	Synthetic peptide (NH2-) [LL-37, 37 aa] (-COOH)					Polyclonal	More info
Dicer (human)	Synthetic peptide (NH2-) SNTDKWEKDEMTKDC (-COOH) conjugated to KLH					Polyclonal	More info

We also provide custom peptides and custom peptide polyclonal antibodies!